SCOP 1.69: Domain d1sdia_: 1sdi A:

Lineage for d1sdia_ (1sdi A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.198: YcfC-like [101321] (1 superfamily)
   multihelical; contains two buried central helices

4. Superfamily a.198.1: YcfC-like [101322] (1 family)

5. Family a.198.1.1: YcfC-like [101323] (1 protein)
   pfam 04356: protein of unknown function (DUF489)

6. Protein Hypothetical protein YcfC [101324] (1 species)

7. Species Escherichia coli [TaxId:562] [101325] (2 PDB entries)

8. Domain d1sdia_: 1sdi A: [105437]
   Structural genomics target

Details for d1sdia_

PDB Entry: 1sdi, 1.65 Å

PDB Description: 1.65 A structure of Escherichia coli ycfC gene product

SCOP Domain Sequences for d1sdia_:

Sequence; same for both SEQRES and ATOM records:

>d1sdia_ a.198.1.1 (A:) Hypothetical protein YcfC {Escherichia coli}
gaknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggsea
nlrvgletllgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrql
ehfdlqsetlmsamaaiyvdvisplgpriqvtgspavlqspqvqakvratllagiraavl
whqvgggrlqlmfsrnrlttqakqilahltpel

Timeline for d1sdia_:

• d1sdia_ is new in SCOP 1.69
  
• d1sdia_ appears in SCOP 1.71
  
• d1sdia_ appears in the current release, SCOPe 2.08, called d1sdia1