Lineage for d1sdia1 (1sdi A:2-213)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736363Fold a.198: YcfC-like [101321] (1 superfamily)
    multihelical; contains two buried central helices
  4. 2736364Superfamily a.198.1: YcfC-like [101322] (1 family) (S)
    automatically mapped to Pfam PF04356
  5. 2736365Family a.198.1.1: YcfC-like [101323] (1 protein)
    Pfam PF04356; DUF489
  6. 2736366Protein Hypothetical protein YcfC [101324] (1 species)
  7. 2736367Species Escherichia coli [TaxId:562] [101325] (2 PDB entries)
    Uniprot P25746
  8. 2736368Domain d1sdia1: 1sdi A:2-213 [105437]
    Other proteins in same PDB: d1sdia2
    Structural genomics target
    complexed with acy, mpd

Details for d1sdia1

PDB Entry: 1sdi (more details), 1.65 Å

PDB Description: 1.65 A structure of Escherichia coli ycfC gene product
PDB Compounds: (A:) Hypothetical protein ycfC

SCOPe Domain Sequences for d1sdia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sdia1 a.198.1.1 (A:2-213) Hypothetical protein YcfC {Escherichia coli [TaxId: 562]}
aknyyditlalagicqsarlvqqlahqghcdadalhvslnsiidmnpsstlavfggsean
lrvgletllgvlnassrqglnaeltrytlslmvlerklssakgaldtlgnringlqrqle
hfdlqsetlmsamaaiyvdvisplgpriqvtgspavlqspqvqakvratllagiraavlw
hqvgggrlqlmfsrnrlttqakqilahltpel

SCOPe Domain Coordinates for d1sdia1:

Click to download the PDB-style file with coordinates for d1sdia1.
(The format of our PDB-style files is described here.)

Timeline for d1sdia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sdia2