Class b: All beta proteins [48724] (178 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) automatically mapped to Pfam PF00754 |
Protein C2 domain of factor V [49792] (2 species) |
Species Cow (Bos taurus) [TaxId:9913] [110117] (1 PDB entry) Uniprot Q28107 29-324,1566-2210 |
Domain d1sddb4: 1sdd B:2025-2182 [105436] Other proteins in same PDB: d1sdda1, d1sdda2, d1sddb1, d1sddb2 complexed with ca, cu, nag, ndg |
PDB Entry: 1sdd (more details), 2.8 Å
SCOPe Domain Sequences for d1sddb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sddb4 b.18.1.2 (B:2025-2182) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]} cstplgmesgkienkqitassfkkswwgnywepflarlnaqgrvnawqakannnnqwlqi dllkikkitaivtqgckslssemyvksytihysdqgtdwkpyrekssmvdkifegnnnvr ghvknffnppiisrfiriipktwnqsialrlelfgcdm
Timeline for d1sddb4: