Lineage for d1sddb3 (1sdd B:1863-2024)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 792828Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (3 proteins)
  6. 792835Protein C2 domain of factor V [49792] (2 species)
  7. 792836Species Cow (Bos taurus) [TaxId:9913] [110117] (1 PDB entry)
    Uniprot Q28107 29-324,1566-2210
  8. 792837Domain d1sddb3: 1sdd B:1863-2024 [105435]
    Other proteins in same PDB: d1sdda1, d1sdda2, d1sddb1, d1sddb2

Details for d1sddb3

PDB Entry: 1sdd (more details), 2.8 Å

PDB Description: Crystal Structure of Bovine Factor Vai
PDB Compounds: (B:) Coagulation factor V

SCOP Domain Sequences for d1sddb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus) [TaxId: 9913]}
dreckmpmglstgliadsqiqasefwgywepklarlnnggsynawiaeklstefnpepwi
qvdmqkevlltgiqtqgakhylkpyyttefcvaysldrknwrifkgnstrnvmyfggnsd
astikenqidppvvaryirisptgsynkpalrlelqgcevng

SCOP Domain Coordinates for d1sddb3:

Click to download the PDB-style file with coordinates for d1sddb3.
(The format of our PDB-style files is described here.)

Timeline for d1sddb3: