SCOP 1.69: Domain d1sddb3: 1sdd B:1863-2024

Lineage for d1sddb3 (1sdd B:1863-2024)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (24 families)

5. Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (3 proteins)

6. Protein C2 domain of factor V [49792] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [110117] (1 PDB entry)

8. Domain d1sddb3: 1sdd B:1863-2024 [105435]
   Other proteins in same PDB: d1sdda1, d1sdda2, d1sddb1, d1sddb2

Details for d1sddb3

PDB Entry: 1sdd, 2.8 Å

PDB Description: crystal structure of bovine factor vai

SCOP Domain Sequences for d1sddb3:

Sequence; same for both SEQRES and ATOM records:

>d1sddb3 b.18.1.2 (B:1863-2024) C2 domain of factor V {Cow (Bos taurus)}
dreckmpmglstgliadsqiqasefwgywepklarlnnggsynawiaeklstefnpepwi
qvdmqkevlltgiqtqgakhylkpyyttefcvaysldrknwrifkgnstrnvmyfggnsd
astikenqidppvvaryirisptgsynkpalrlelqgcevng

Timeline for d1sddb3:

• d1sddb3 is new in SCOP 1.69
  
• d1sddb3 appears in SCOP 1.71
  
• d1sddb3 appears in the current release, SCOPe 2.08