![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
![]() | Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
![]() | Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins) |
![]() | Protein Coagulation factor V [110103] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [110104] (1 PDB entry) Uniprot Q28107 29-324, 1566-2210 |
![]() | Domain d1sddb2: 1sdd B:1724-1862 [105434] Other proteins in same PDB: d1sddb3, d1sddb4 complexed with ca, cu, nag |
PDB Entry: 1sdd (more details), 2.8 Å
SCOPe Domain Sequences for d1sddb2:
Sequence, based on SEQRES records: (download)
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} dmrefvllfmvfdekkswyydkkptrswrrassevknshefhaingmiynlpglrmyeqe wvrlhllnlggsrdihvvhfhgqtllengtqqhqlgvwpllpgsfktlemkaskpgwwll dtevgeiqragmqtpfliv
>d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} dmrefvllfmvfdekkswyydnshefhaingmiynlpglrmyeqewvrlhllnlggsrdi hvvhfhgqtllengtqqhqlgvwpllpgsfktlemkaskpgwwlldtevgeiqragmqtp fliv
Timeline for d1sddb2: