SCOPe 2.08: Domain d1sddb1: 1sdd B:1657-1723

Lineage for d1sddb1 (1sdd B:1657-1723)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)

6. Protein Coagulation factor V [110103] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [110104] (1 PDB entry)
   Uniprot Q28107 29-324, 1566-2210

8. Domain d1sddb1: 1sdd B:1657-1723 [105433]
   Other proteins in same PDB: d1sddb3, d1sddb4
   complexed with ca, cu, nag
   fragment; missing more than one-third of the common structure and/or sequence

Details for d1sddb1

PDB Entry: 1sdd, 2.8 Å

PDB Description: crystal structure of bovine factor vai

PDB Compounds: (B:) Coagulation factor V

SCOPe Domain Sequences for d1sddb1:

Sequence; same for both SEQRES and ATOM records:

>d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}
naiqpnktytyvwhattrsgpenpgsacrawayysavnpekdihsgligpllicrkgtld
ketnmpv

Timeline for d1sddb1:

• d1sddb1 first appeared in SCOP 1.69
  
• d1sddb1 appears in SCOPe 2.07