Lineage for d1sdda2 (1sdd A:181-296)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 791145Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 791146Superfamily b.6.1: Cupredoxins [49503] (7 families) (S)
    contains copper-binding site
  5. 791546Family b.6.1.3: Multidomain cupredoxins [49550] (7 proteins)
  6. 791586Protein Coagulation factor V [110103] (1 species)
  7. 791587Species Cow (Bos taurus) [TaxId:9913] [110104] (1 PDB entry)
    Uniprot Q28107 29-324, 1566-2210
  8. 791589Domain d1sdda2: 1sdd A:181-296 [105432]
    Other proteins in same PDB: d1sddb3, d1sddb4

Details for d1sdda2

PDB Entry: 1sdd (more details), 2.8 Å

PDB Description: Crystal Structure of Bovine Factor Vai
PDB Compounds: (A:) Coagulation factor V

SCOP Domain Sequences for d1sdda2:

Sequence, based on SEQRES records: (download)

>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}
kqhvlmfavfdeskswnqtsslmytvngyvngtmpditvcahdhiswhligmssgpelfs
ihfngqvleqnhhkisaitlvsatsttanmtvspegrwtiasliprhfqagmqayi

Sequence, based on observed residues (ATOM records): (download)

>d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]}
kqhvlmfavfdeskswnqtsslmytvngyvngtmpditvcahligmssgpelfsihfngq
vleqnhhkisaitlvsatsttgrwtiasliprhfqagmqayi

SCOP Domain Coordinates for d1sdda2:

Click to download the PDB-style file with coordinates for d1sdda2.
(The format of our PDB-style files is described here.)

Timeline for d1sdda2: