Lineage for d1sd5a_ (1sd5 A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. Protein Probable two-component system transcriptional regulator Rv1626 [110464] (1 species)
    contains extra C-terminal all-alpha subdomain (144-20), 3-helical bundle
  7. Species Mycobacterium tuberculosis [TaxId:1773] [110465] (2 PDB entries)
    Uniprot O06143
  8. Domain d1sd5a_: 1sd5 A: [105430]
    Structural genomics target
    complexed with iod

Details for d1sd5a_

PDB Entry: 1sd5 (more details), 1.68 Å

PDB Description: Crystal structure of Rv1626
PDB Compounds: (A:) putative antiterminator

SCOPe Domain Sequences for d1sd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sd5a_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]}
prrvliaedealirmdlaemlreegyeivgeagdgqeavelaelhkpdlvimdvkmprrd
gidaaseiaskriapivvltafsqrdlverardagamaylvkpfsisdlipaielavsrf
reitalegevatlserletrklverakgllqtkhgmtepdafkwiqraamdrrttmkrva
evvletlg

SCOPe Domain Coordinates for d1sd5a_ are not available.

Timeline for d1sd5a_: