![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein Probable two-component system transcriptional regulator Rv1626 [110464] (1 species) contains extra C-terminal all-alpha subdomain (144-20), 3-helical bundle |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [110465] (2 PDB entries) Uniprot O06143 |
![]() | Domain d1sd5a_: 1sd5 A: [105430] Structural genomics target complexed with iod |
PDB Entry: 1sd5 (more details), 1.68 Å
SCOPe Domain Sequences for d1sd5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sd5a_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]} prrvliaedealirmdlaemlreegyeivgeagdgqeavelaelhkpdlvimdvkmprrd gidaaseiaskriapivvltafsqrdlverardagamaylvkpfsisdlipaielavsrf reitalegevatlserletrklverakgllqtkhgmtepdafkwiqraamdrrttmkrva evvletlg
Timeline for d1sd5a_: