![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.39: Penicillinase repressor [101016] (4 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain |
![]() | Protein Penicillinase repressor BlaI [101019] (2 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [109666] (1 PDB entry) Uniprot Q9K4N1 |
![]() | Domain d1sd4b_: 1sd4 B: [105429] complexed with so4 |
PDB Entry: 1sd4 (more details), 2 Å
SCOPe Domain Sequences for d1sd4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sd4b_ a.4.5.39 (B:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]} qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis kk
Timeline for d1sd4b_: