Lineage for d1sd4b_ (1sd4 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983234Family a.4.5.39: Penicillinase repressor [101016] (4 protein domains)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
    automatically mapped to Pfam PF03965
  6. 1983253Protein Penicillinase repressor BlaI [101019] (2 species)
  7. 1983257Species Staphylococcus aureus [TaxId:1280] [109666] (1 PDB entry)
    Uniprot Q9K4N1
  8. 1983259Domain d1sd4b_: 1sd4 B: [105429]
    complexed with so4

Details for d1sd4b_

PDB Entry: 1sd4 (more details), 2 Å

PDB Description: Crystal Structure of a SeMet derivative of BlaI at 2.0 A
PDB Compounds: (B:) Penicillinase repressor

SCOPe Domain Sequences for d1sd4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sd4b_ a.4.5.39 (B:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]}
qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse
niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis
kk

SCOPe Domain Coordinates for d1sd4b_:

Click to download the PDB-style file with coordinates for d1sd4b_.
(The format of our PDB-style files is described here.)

Timeline for d1sd4b_: