Lineage for d1sd4a_ (1sd4 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722450Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
    homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
    automatically mapped to Pfam PF03965
  6. 1722469Protein Penicillinase repressor BlaI [101019] (2 species)
  7. 1722473Species Staphylococcus aureus [TaxId:1280] [109666] (1 PDB entry)
    Uniprot Q9K4N1
  8. 1722474Domain d1sd4a_: 1sd4 A: [105428]
    complexed with so4

Details for d1sd4a_

PDB Entry: 1sd4 (more details), 2 Å

PDB Description: Crystal Structure of a SeMet derivative of BlaI at 2.0 A
PDB Compounds: (A:) Penicillinase repressor

SCOPe Domain Sequences for d1sd4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]}
qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse
niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis
kk

SCOPe Domain Coordinates for d1sd4a_:

Click to download the PDB-style file with coordinates for d1sd4a_.
(The format of our PDB-style files is described here.)

Timeline for d1sd4a_: