SCOP 1.69: Domain d1sd4a_: 1sd4 A:

Lineage for d1sd4a_ (1sd4 A:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (2 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain

6. Protein Penicillinase repressor BlaI [101019] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [109666] (1 PDB entry)

8. Domain d1sd4a_: 1sd4 A: [105428]

Details for d1sd4a_

PDB Entry: 1sd4, 2 Å

PDB Description: Crystal Structure of a SeMet derivative of BlaI at 2.0 A

SCOP Domain Sequences for d1sd4a_:

Sequence; same for both SEQRES and ATOM records:

>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus}
qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse
niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis
kk

Timeline for d1sd4a_:

• d1sd4a_ is new in SCOP 1.69
  
• d1sd4a_ appears in SCOP 1.71
  
• d1sd4a_ appears in the current release, SCOPe 2.08