Class a: All alpha proteins [46456] (218 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (13 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (55 families) contains a small beta-sheet (wing) |
Family a.4.5.39: Penicillinase repressor [101016] (2 proteins) homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain |
Protein Penicillinase repressor BlaI [101019] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [109666] (1 PDB entry) |
Domain d1sd4a_: 1sd4 A: [105428] |
PDB Entry: 1sd4 (more details), 2 Å
SCOP Domain Sequences for d1sd4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus} qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis kk
Timeline for d1sd4a_: