SCOPe 2.08: Domain d1sd4a_: 1sd4 A:

Lineage for d1sd4a_ (1sd4 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.39: Penicillinase repressor [101016] (4 proteins)
   homologous to the MarR-like family in the DNA-binding region but has a different dimerisation subdomain
   automatically mapped to Pfam PF03965

6. Protein Penicillinase repressor BlaI [101019] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [109666] (1 PDB entry)
   Uniprot Q9K4N1

8. Domain d1sd4a_: 1sd4 A: [105428]
   complexed with so4

Details for d1sd4a_

PDB Entry: 1sd4, 2 Å

PDB Description: Crystal Structure of a SeMet derivative of BlaI at 2.0 A

PDB Compounds: (A:) Penicillinase repressor

SCOPe Domain Sequences for d1sd4a_:

Sequence; same for both SEQRES and ATOM records:

>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]}
qveismaewdvmniiwdkksvsaneivveiqkykevsdktirtlitrlykkeiikrykse
niyfyssnikeddikmktaktflnklyggdmkslvlnfakneelnnkeieelrdilndis
kk

Timeline for d1sd4a_:

• d1sd4a_ first appeared in SCOP 1.69
  
• d1sd4a_ appears in SCOPe 2.07