SCOPe 2.06: Domain d1sd0a2: 1sd0 A:96-357

Lineage for d1sd0a2 (1sd0 A:96-357)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
   automatically mapped to Pfam PF00217

6. Protein Arginine kinase, C-terminal domain [55942] (2 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [55943] (14 PDB entries)
   Uniprot P51541

8. Domain d1sd0a2: 1sd0 A:96-357 [105425]
   Other proteins in same PDB: d1sd0a1
   complexed with adp, arg, cl, mg, no3; mutant

Details for d1sd0a2

PDB Entry: 1sd0, 2.3 Å

PDB Description: structure of arginine kinase c271a mutant

PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d1sd0a2:

Sequence; same for both SEQRES and ATOM records:

>d1sd0a2 d.128.1.2 (A:96-357) Arginine kinase, C-terminal domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
tdkhppkqwgdintlvgldpagqfiistrvrcgrslqgypfnpcltaeqykemeekvsst
lssmedelkgtyypltgmskatqqqliddhflfkegdrflqtanacrywptgrgifhnda
ktflvwvneedhlriismqkggdlktvykrlvtavdniesklpfshddrfgfltfaptnl
gttmrasvhiqlpklakdrkvlediaskfnlqvrgtrgehteseggvydisnkrrlglte
yqavremqdgilemirmekaaa

Timeline for d1sd0a2:

• d1sd0a2 first appeared in SCOP 1.69
  
• d1sd0a2 appears in SCOPe 2.05
  
• d1sd0a2 appears in SCOPe 2.07
  
• d1sd0a2 appears in the current release, SCOPe 2.08