SCOPe 2.01: Domain d1sd0a1: 1sd0 A:2-95

Lineage for d1sd0a1 (1sd0 A:2-95)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (1 family)

5. Family a.83.1.1: Guanido kinase N-terminal domain [48035] (2 proteins)

6. Protein Arginine kinase, N-domain [48042] (1 species)

7. Species Horseshoe crab (Limulus polyphemus) [TaxId:6850] [48043] (7 PDB entries)
   Uniprot P51541

8. Domain d1sd0a1: 1sd0 A:2-95 [105424]
   Other proteins in same PDB: d1sd0a2
   complexed with adp, arg, cl, mg, no3; mutant

Details for d1sd0a1

PDB Entry: 1sd0, 2.3 Å

PDB Description: structure of arginine kinase c271a mutant

PDB Compounds: (A:) arginine kinase

SCOPe Domain Sequences for d1sd0a1:

Sequence; same for both SEQRES and ATOM records:

>d1sd0a1 a.83.1.1 (A:2-95) Arginine kinase, N-domain {Horseshoe crab (Limulus polyphemus) [TaxId: 6850]}
vdqatldkleagfkklqeasdcksllkkhltkdvfdsiknkktgmgatlldviqsgvenl
dsgvgiyapdaesyrtfgplfdpiiddyhggfkl

Timeline for d1sd0a1:

• d1sd0a1 first appeared in SCOP 1.69
  
• d1sd0a1 appears in SCOP 1.75
  
• d1sd0a1 appears in SCOPe 2.02
  
• d1sd0a1 appears in the current release, SCOPe 2.08