Lineage for d1scwa_ (1scw A:)
- Root: SCOP 1.69
Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds) 
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
contains a cluster of helices and an alpha+beta sandwichSuperfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families) 
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins) 
Protein D-ala carboxypeptidase/transpeptidase [56603] (2 species) Species Streptomyces sp., R61 [TaxId:1931] [56605] (13 PDB entries) 
Domain d1scwa_: 1scw A: [105423]
Details for d1scwa_
PDB Entry: 1scw (more details), 1.13 Å
PDB Description: toward better antibiotics: crystal structure of r61 dd-peptidase inhibited by a novel monocyclic phosphate inhibitor
SCOP Domain Sequences for d1scwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1scwa_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61}
lpapddtglqavlhtalsqgapgamvrvddngtihqlsegvadratgraitttdrfrvgs
vtksfsavvllqlvdegkldldasvntylpgllpddritvrqvmshrsglydytndmfaq
tvpgfesvrnkvfsyqdlitlslkhgvtnapgaaysysntnfvvagmliekltghsvate
yqnriftplnltdtfyvhpdtvipgthangyltpdeaggalvdsteqtvswaqsagavis
stqdldtffsalmsgqlmsaaqlaqmqqwttvnstqgyglglrrrdlscgisvyghtgtv
qgyytyafaskdgkrsvtalantsnnvnvlntmartlesafcgkp
SCOP Domain Coordinates for d1scwa_:
Click to download the PDB-style file with coordinates for d1scwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1scwa_:
- d1scwa_ is new in SCOP 1.69
- d1scwa_ appears in SCOP 1.71
- d1scwa_ appears in the current release, SCOPe 2.08
View in 3D