Lineage for d1scqa_ (1scq A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 590154Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 590155Superfamily c.69.1: alpha/beta-Hydrolases [53474] (35 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 590684Family c.69.1.20: Hydroxynitrile lyase-like [53585] (2 proteins)
  6. 590685Protein Hydroxynitrile lyase [53586] (2 species)
  7. 590701Species Rubber tree (Hevea brasiliensis) [TaxId:3981] [53587] (12 PDB entries)
  8. 590713Domain d1scqa_: 1scq A: [105422]
    complexed with cnh, so4; mutant

Details for d1scqa_

PDB Entry: 1scq (more details), 2.9 Å

PDB Description: k236l mutant of hydroxynitrile lyase from hevea brasiliensis in complex with acetonecyanohydrin

SCOP Domain Sequences for d1scqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1scqa_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis)}
afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhllqltk
tkeiaeilqevadtyn

SCOP Domain Coordinates for d1scqa_:

Click to download the PDB-style file with coordinates for d1scqa_.
(The format of our PDB-style files is described here.)

Timeline for d1scqa_: