Lineage for d1sc8u_ (1sc8 U:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 803442Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 803443Species Human (Homo sapiens) [TaxId:9606] [50587] (49 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 803486Domain d1sc8u_: 1sc8 U: [105418]
    complexed with 2in, so4; mutant

Details for d1sc8u_

PDB Entry: 1sc8 (more details), 2.4 Å

PDB Description: urokinase plasminogen activator b-chain-j435 complex
PDB Compounds: (U:) Plasminogen activator, urokinase

SCOP Domain Sequences for d1sc8u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sc8u_ b.47.1.2 (U:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke

SCOP Domain Coordinates for d1sc8u_:

Click to download the PDB-style file with coordinates for d1sc8u_.
(The format of our PDB-style files is described here.)

Timeline for d1sc8u_: