Lineage for d1sc4.1 (1sc4 A:,B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 480831Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 480832Superfamily c.17.1: Caspase-like [52129] (2 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 480833Family c.17.1.1: Caspase catalytic domain [52130] (7 proteins)
  6. 480910Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species)
  7. 480911Species Human (Homo sapiens) [TaxId:9606] [52134] (6 PDB entries)
  8. 480913Domain d1sc4.1: 1sc4 A:,B: [105417]

Details for d1sc4.1

PDB Entry: 1sc4 (more details), 2.1 Å

PDB Description: crystal structure of the human caspase-1 c285a mutant after removal of malonate

SCOP Domain Sequences for d1sc4.1:

Sequence, based on SEQRES records: (download)

>g1sc4.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens)}
nvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaevditgmtm
llqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregicgkkhseq
vpdilqlnaifnmlntkncpslkdkpkviiiqaargdspgvvwfkdXaikkahiekdfia
fcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsfeqpdgraqmptt
ervtltrcfylfpgh

Sequence, based on observed residues (ATOM records): (download)

>g1sc4.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens)}
nvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaevditgmtm
llqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregicgkkhseq
vpdilqlnaifnmlntkncpslkdkpkviiiqaargdspgvvwfkdXaikkahiekdfia
fcsstpdngsvfigrliehmqeyacscdveeifrkvrfsfeqpdgraqmpttervtltrc
fylfpgh

SCOP Domain Coordinates for d1sc4.1:

Click to download the PDB-style file with coordinates for d1sc4.1.
(The format of our PDB-style files is described here.)

Timeline for d1sc4.1: