SCOPe 2.08: Domain d1sc3.1: 1sc3 A:,B:

Lineage for d1sc3.1 (1sc3 A:,B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.17: Caspase-like [52128] (1 superfamily)
   3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest

4. Superfamily c.17.1: Caspase-like [52129] (3 families)
   mature protein may be composed of two chains folded in a single domain

5. Family c.17.1.1: Caspase catalytic domain [52130] (8 proteins)

6. Protein Interleukin-1beta converting enzyme (a cysteine protease) [52133] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52134] (14 PDB entries)
   Uniprot P29466 125-297,317-404

8. Domain d1sc3.1: 1sc3 A:,B: [105416]
   complexed with mli; mutant

Details for d1sc3.1

PDB Entry: 1sc3, 1.8 Å

PDB Description: crystal structure of the human caspase-1 c285a mutant in complex with malonate

PDB Compounds: (A:) Interleukin-1 beta convertase, (B:) Interleukin-1 beta convertase

SCOPe Domain Sequences for d1sc3.1:

Sequence; same for both SEQRES and ATOM records:

>g1sc3.1 c.17.1.1 (A:,B:) Interleukin-1beta converting enzyme (a cysteine protease) {Human (Homo sapiens) [TaxId: 9606]}
tssgsegnvklcsleeaqriwkqksaeiypimdkssrtrlaliicneefdsiprrtgaev
ditgmtmllqnlgysvdvkknltasdmtteleafahrpehktsdstflvfmshgiregic
gkkhseqvpdilqlnaifnmlntkncpslkdkpkviiiqaargdspgvvwfkdXaikkah
iekdfiafcsstpdnvswrhptmgsvfigrliehmqeyacscdveeifrkvrfsfeqpdg
raqmpttervtltrcfylfpgh

Timeline for d1sc3.1:

• d1sc3.1 first appeared in SCOP 1.69
  
• d1sc3.1 appears in SCOPe 2.07