![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
![]() | Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) ![]() |
![]() | Family a.6.1.4: Dachshund-homology domain [74693] (3 proteins) Pfam PF02437 |
![]() | Protein Ski oncogene [109742] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [109743] (1 PDB entry) Uniprot P12755 91-192 |
![]() | Domain d1sbxa_: 1sbx A: [105414] |
PDB Entry: 1sbx (more details), 1.65 Å
SCOPe Domain Sequences for d1sbxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbxa_ a.6.1.4 (A:) Ski oncogene {Human (Homo sapiens) [TaxId: 9606]} gshmfmpsdrstercetvlegetiscfvvggekrlclpqilnsvlrdfslqqinavcdel hiycsrctadqleilkvmgilpfsapscglitktdaerlcnallyg
Timeline for d1sbxa_: