Lineage for d1sbxa_ (1sbx A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724238Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1724239Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1724305Family a.6.1.4: Dachshund-homology domain [74693] (3 proteins)
    Pfam PF02437
  6. 1724310Protein Ski oncogene [109742] (1 species)
  7. 1724311Species Human (Homo sapiens) [TaxId:9606] [109743] (1 PDB entry)
    Uniprot P12755 91-192
  8. 1724312Domain d1sbxa_: 1sbx A: [105414]

Details for d1sbxa_

PDB Entry: 1sbx (more details), 1.65 Å

PDB Description: Crystal structure of the Dachshund-homology domain of human SKI
PDB Compounds: (A:) Ski oncogene

SCOPe Domain Sequences for d1sbxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbxa_ a.6.1.4 (A:) Ski oncogene {Human (Homo sapiens) [TaxId: 9606]}
gshmfmpsdrstercetvlegetiscfvvggekrlclpqilnsvlrdfslqqinavcdel
hiycsrctadqleilkvmgilpfsapscglitktdaerlcnallyg

SCOPe Domain Coordinates for d1sbxa_:

Click to download the PDB-style file with coordinates for d1sbxa_.
(The format of our PDB-style files is described here.)

Timeline for d1sbxa_: