Lineage for d1sbxa1 (1sbx A:90-192)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985062Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 1985063Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 1985129Family a.6.1.4: Dachshund-homology domain [74693] (3 protein domains)
    Pfam PF02437
  6. 1985134Protein Ski oncogene [109742] (1 species)
  7. 1985135Species Human (Homo sapiens) [TaxId:9606] [109743] (1 PDB entry)
    Uniprot P12755 91-192
  8. 1985136Domain d1sbxa1: 1sbx A:90-192 [105414]
    Other proteins in same PDB: d1sbxa2

Details for d1sbxa1

PDB Entry: 1sbx (more details), 1.65 Å

PDB Description: Crystal structure of the Dachshund-homology domain of human SKI
PDB Compounds: (A:) Ski oncogene

SCOPe Domain Sequences for d1sbxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbxa1 a.6.1.4 (A:90-192) Ski oncogene {Human (Homo sapiens) [TaxId: 9606]}
mfmpsdrstercetvlegetiscfvvggekrlclpqilnsvlrdfslqqinavcdelhiy
csrctadqleilkvmgilpfsapscglitktdaerlcnallyg

SCOPe Domain Coordinates for d1sbxa1:

Click to download the PDB-style file with coordinates for d1sbxa1.
(The format of our PDB-style files is described here.)

Timeline for d1sbxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1sbxa2