SCOPe 2.08: Domain d1sbxa1: 1sbx A:90-192

Lineage for d1sbxa1 (1sbx A:90-192)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.4: Dachshund-homology domain [74693] (3 proteins)
   Pfam PF02437

6. Protein Ski oncogene [109742] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [109743] (1 PDB entry)
   Uniprot P12755 91-192

8. Domain d1sbxa1: 1sbx A:90-192 [105414]
   Other proteins in same PDB: d1sbxa2

Details for d1sbxa1

PDB Entry: 1sbx, 1.65 Å

PDB Description: Crystal structure of the Dachshund-homology domain of human SKI

PDB Compounds: (A:) Ski oncogene

SCOPe Domain Sequences for d1sbxa1:

Sequence; same for both SEQRES and ATOM records:

>d1sbxa1 a.6.1.4 (A:90-192) Ski oncogene {Human (Homo sapiens) [TaxId: 9606]}
mfmpsdrstercetvlegetiscfvvggekrlclpqilnsvlrdfslqqinavcdelhiy
csrctadqleilkvmgilpfsapscglitktdaerlcnallyg

Timeline for d1sbxa1:

• d1sbxa1 first appeared in SCOP 1.69, called d1sbxa_
  
• d1sbxa1 appears in SCOPe 2.07