Lineage for d1sbqa_ (1sbq A:)
- Root: SCOP 1.69
Class c: Alpha and beta proteins (a/b) [51349] (136 folds) 
Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (6 families) 
Family c.124.1.6: Methenyltetrahydrofolate synthetase (5-FTHF cyclo-ligase; Pfam 01812) [110520] (2 proteins) Protein 5,10-methenyltetrahydrofolate synthetase homolog MPN348 [110523] (1 species) Species Mycoplasma pneumoniae [TaxId:2104] [110524] (1 PDB entry) 
Domain d1sbqa_: 1sbq A: [105412]
Details for d1sbqa_
PDB Entry: 1sbq (more details), 2.2 Å
PDB Description: Crystal Structure of methenyltetrahydrofolate synthetase from Mycoplasma pneumoniae at 2.2 resolution
SCOP Domain Sequences for d1sbqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbqa_ c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase homolog MPN348 {Mycoplasma pneumoniae}
mdknalrkqilqkrmalstiekshldqkinqklvafltpkpciktialyepiknevtfvd
fffeflkinqiravypkvisdteiifidqetntfepnqidcfliplvgfnkdnyrlgfgk
gyydrylmqltrqqpkigiaysfqkgdfladpwdvqldliinde
SCOP Domain Coordinates for d1sbqa_:
Click to download the PDB-style file with coordinates for d1sbqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1sbqa_:
- d1sbqa_ is new in SCOP 1.69
- d1sbqa_ appears in SCOP 1.71
- d1sbqa_ appears in the current release, SCOPe 2.08
View in 3D
