Lineage for d1sb9a_ (1sb9 A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 820701Protein UDP-N-acetylglucosamine 4-epimerase WbpP [110407] (1 species)
  7. 820702Species Pseudomonas aeruginosa [TaxId:287] [110408] (2 PDB entries)
    Uniprot Q8KN66 # list: Q8GGB8 Q9RHD6 99% identity
  8. 820704Domain d1sb9a_: 1sb9 A: [105411]
    complexed with nad, upg

Details for d1sb9a_

PDB Entry: 1sb9 (more details), 2.5 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa UDP-N-acetylglucosamine 4-epimerase complexed with UDP-glucose
PDB Compounds: (A:) wbpP

SCOP Domain Sequences for d1sb9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sb9a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]}
msryeelrkelpaqpkvwlitgvagfigsnlletllkldqkvvgldnfatghqrnldevr
slvsekqwsnfkfiqgdirnlddcnnacagvdyvlhqaalgsvprsindpitsnatnidg
flnmliaardakvqsftyaassstygdhpglpkvedtigkplspyavtkyvnelyadvfs
rcygfstiglryfnvfgrrqdpngayaavipkwtssmiqgddvyingdgetsrdfcyien
tvqanllaatagldarnqvyniavggrtslnqlffalrdglaengvsyhrepvyrdfreg
dvrhsladiskaakllgyapkydvsagvalampwyimflk

SCOP Domain Coordinates for d1sb9a_:

Click to download the PDB-style file with coordinates for d1sb9a_.
(The format of our PDB-style files is described here.)

Timeline for d1sb9a_: