SCOPe 2.08: Domain d1sb8a_: 1sb8 A:

Lineage for d1sb8a_ (1sb8 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein UDP-N-acetylglucosamine 4-epimerase WbpP [110407] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110408] (2 PDB entries)
   Uniprot Q8KN66 # list: Q8GGB8 Q9RHD6 99% identity

8. Domain d1sb8a_: 1sb8 A: [105410]
   complexed with nad, ud2
   has additional subdomain(s) that are not in the common domain

Details for d1sb8a_

PDB Entry: 1sb8, 2.1 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa UDP-N-acetylglucosamine 4-epimerase complexed with UDP-N-acetylgalactosamine

PDB Compounds: (A:) wbpP

SCOPe Domain Sequences for d1sb8a_:

Sequence; same for both SEQRES and ATOM records:

>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]}
mmsryeelrkelpaqpkvwlitgvagfigsnlletllkldqkvvgldnfatghqrnldev
rslvsekqwsnfkfiqgdirnlddcnnacagvdyvlhqaalgsvprsindpitsnatnid
gflnmliaardakvqsftyaassstygdhpglpkvedtigkplspyavtkyvnelyadvf
srcygfstiglryfnvfgrrqdpngayaavipkwtssmiqgddvyingdgetsrdfcyie
ntvqanllaatagldarnqvyniavggrtslnqlffalrdglaengvsyhrepvyrdfre
gdvrhsladiskaakllgyapkydvsagvalampwyimflk

Timeline for d1sb8a_:

• d1sb8a_ first appeared in SCOP 1.69
  
• d1sb8a_ appears in SCOPe 2.07