SCOPe 2.08: Domain d1sb7a1: 1sb7 A:1-341

Lineage for d1sb7a1 (1sb7 A:1-341)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (5 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.4: tRNA pseudouridine synthase TruD [103021] (1 protein)
   natural circular permutation in the catalytic domain; insertion of the family-specific alpha+beta subdomain
   automatically mapped to Pfam PF01142

6. Protein tRNA pseudouridine synthase TruD [103022] (1 species)

7. Species Escherichia coli [TaxId:562] [103023] (3 PDB entries)
   Uniprot Q57261
   family-specific insert subdomain: res. 158-301

8. Domain d1sb7a1: 1sb7 A:1-341 [105408]
   Other proteins in same PDB: d1sb7a2, d1sb7b2
   complexed with gol, po4

Details for d1sb7a1

PDB Entry: 1sb7, 2.2 Å

PDB Description: Crystal structure of the E.coli pseudouridine synthase TruD

PDB Compounds: (A:) tRNA pseudouridine synthase D

SCOPe Domain Sequences for d1sb7a1:

Sequence; same for both SEQRES and ATOM records:

>d1sb7a1 d.265.1.4 (A:1-341) tRNA pseudouridine synthase TruD {Escherichia coli [TaxId: 562]}
miefdnltylhgkpqgtgllkanpedfvvvedlgfepdgegehilvrilkngcntrfvad
alakflkiharevsfagqkdkhavteqwlcarvpgkempdlsafqlegcqvleyarhkrk
lrlgalkgnaftlvlrevsnrddveqrlidicvkgvpnyfgaqrfgiggsnlqgaqrwaq
tntpvrdrnkrsfwlsaarsalfnqivaerlkkadvnqvvdgdalqlagrgswfvattee
laelqrrvndkelmitaalpgsgewgtqrealafeqaavaaetelqallvrekveaarra
mllypqqlswnwwddvtveirfwlpagsfatsvvrelintt

Timeline for d1sb7a1:

• d1sb7a1 first appeared in SCOP 1.69, called d1sb7a_
  
• d1sb7a1 appears in SCOPe 2.07