Lineage for d1sb1.1 (1sb1 L:,H:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 465071Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 465072Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 465201Family b.47.1.2: Eukaryotic proteases [50514] (46 protein domains)
  6. 465597Protein Thrombin [50531] (2 species)
  7. 465598Species Cow (Bos taurus) [TaxId:9913] [50533] (26 PDB entries)
  8. 465603Domain d1sb1.1: 1sb1 L:,H: [105407]

Details for d1sb1.1

PDB Entry: 1sb1 (more details), 1.9 Å

PDB Description: Novel Non-Covalent Thrombin Inhibitors Incorporating P1 4,5,6,7-Tetrahydrobenzothiazole Arginine Side Chain Mimetics

SCOP Domain Sequences for d1sb1.1:

Sequence, based on SEQRES records: (download)

>g1sb1.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
eadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta
nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

Sequence, based on observed residues (ATOM records): (download)

>g1sb1.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
eadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcga
slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlkegqps
vlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnr
wyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

SCOP Domain Coordinates for d1sb1.1:

Click to download the PDB-style file with coordinates for d1sb1.1.
(The format of our PDB-style files is described here.)

Timeline for d1sb1.1: