SCOP 1.69: Domain d1sa8a_: 1sa8 A:

Lineage for d1sa8a_ (1sa8 A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (5 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.2: Fatty acid binding protein-like [50847] (16 proteins)
   ten-stranded meander beta-sheet folded upon itself
   relates to the common fold by opening the barrel and insertion of beta-hairpin

6. Protein Intestinal fatty acid binding protein [50851] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [50852] (10 PDB entries)

8. Domain d1sa8a_: 1sa8 A: [105406]
   stable and compact all-beta-sheet variant

Details for d1sa8a_

PDB Entry: 1sa8

PDB Description: the nmr structure of a stable and compact all-beta-sheet variant of intestinal fatty acid-binding protein

SCOP Domain Sequences for d1sa8a_:

Sequence; same for both SEQRES and ATOM records:

>d1sa8a_ b.60.1.2 (A:) Intestinal fatty acid binding protein {Rat (Rattus norvegicus)}
afdgtwkvgglkltitqegnkftvkessnfrnidvvfelgvdfaysladgteltgtwtme
gnklvgkfkrvdngkeliavreisgneliqtytyegveakrifkke

Timeline for d1sa8a_:

• d1sa8a_ is new in SCOP 1.69
  
• d1sa8a_ appears in SCOP 1.71
  
• d1sa8a_ appears in the current release, SCOPe 2.08