Lineage for d1sa8a_ (1sa8 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 467811Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 467812Superfamily b.60.1: Lipocalins [50814] (5 families) (S)
    bind hydrophobic ligands in their interior
  5. 468030Family b.60.1.2: Fatty acid binding protein-like [50847] (16 protein domains)
    ten-stranded meander beta-sheet folded upon itself
    relates to the common fold by opening the barrel and insertion of beta-hairpin
  6. 468123Protein Intestinal fatty acid binding protein [50851] (2 species)
  7. 468128Species Rat (Rattus norvegicus) [TaxId:10116] [50852] (10 PDB entries)
  8. 468135Domain d1sa8a_: 1sa8 A: [105406]
    stable and compact all-beta-sheet variant

Details for d1sa8a_

PDB Entry: 1sa8 (more details)

PDB Description: the nmr structure of a stable and compact all-beta-sheet variant of intestinal fatty acid-binding protein

SCOP Domain Sequences for d1sa8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa8a_ b.60.1.2 (A:) Intestinal fatty acid binding protein {Rat (Rattus norvegicus)}
afdgtwkvgglkltitqegnkftvkessnfrnidvvfelgvdfaysladgteltgtwtme
gnklvgkfkrvdngkeliavreisgneliqtytyegveakrifkke

SCOP Domain Coordinates for d1sa8a_:

Click to download the PDB-style file with coordinates for d1sa8a_.
(The format of our PDB-style files is described here.)

Timeline for d1sa8a_: