Lineage for d1sa4b_ (1sa4 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2722035Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2722506Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 2722636Family a.102.4.3: Protein prenyltransferases [48246] (3 proteins)
  6. 2722637Protein Protein farnesyltransferase, beta-subunit [48247] (2 species)
  7. 2722638Species Human (Homo sapiens) [TaxId:9606] [69090] (13 PDB entries)
    Uniprot P49356
  8. 2722648Domain d1sa4b_: 1sa4 B: [105403]
    Other proteins in same PDB: d1sa4a_
    complexed with fpp, jan, zn

Details for d1sa4b_

PDB Entry: 1sa4 (more details), 2.1 Å

PDB Description: human protein farnesyltransferase complexed with fpp and r115777
PDB Compounds: (B:) Protein farnesyltransferase beta subunit

SCOPe Domain Sequences for d1sa4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa4b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Human (Homo sapiens) [TaxId: 9606]}
sspvwseplyslrpeharerlqddsvetvtsieqakveekiqevfssykfnhlvprlvlq
rekhfhylkrglrqltdayecldasrpwlcywilhslelldepipqivatdvcqflelcq
speggfgggpgqyphlaptyaavnalciigteeaydiinrekllqylyslkqpdgsflmh
vggevdvrsaycaasvasltniitpdlfegtaewiarcqnweggiggvpgmeahggytfc
glaalvilkrerslnlksllqwvtsrqmrfeggfqgrcnklvdgcysfwqagllpllhra
lhaqgdpalsmshwmfhqqalqeyilmccqcpagglldkpgksrdfyhtcyclsglsiaq
hfgsgamlhdvvlgvpenalqpthpvynigpdkviqattyflqkpvpgfe

SCOPe Domain Coordinates for d1sa4b_:

Click to download the PDB-style file with coordinates for d1sa4b_.
(The format of our PDB-style files is described here.)

Timeline for d1sa4b_: