Lineage for d1sa4a_ (1sa4 A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 447406Fold a.118: alpha-alpha superhelix [48370] (20 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 447638Superfamily a.118.6: Protein prenylyltransferase [48439] (1 family) (S)
  5. 447639Family a.118.6.1: Protein prenylyltransferase [48440] (2 proteins)
  6. 447640Protein Protein farnesyltransferase alpha-subunit [48441] (2 species)
  7. 447641Species Human (Homo sapiens) [TaxId:9606] [69093] (6 PDB entries)
  8. 447645Domain d1sa4a_: 1sa4 A: [105402]
    Other proteins in same PDB: d1sa4b_

Details for d1sa4a_

PDB Entry: 1sa4 (more details), 2.1 Å

PDB Description: human protein farnesyltransferase complexed with fpp and r115777

SCOP Domain Sequences for d1sa4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sa4a_ a.118.6.1 (A:) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens)}
fvsldspsyvlyrdraewadidpvpqndgpnpvvqiiysdkfrdvydyfravlqrderse
rafkltrdaielnaanytvwhfrrvllkslqkdlheemnyitaiieeqpknyqvwhhrrv
lvewlrdpsqelefiadilnqdaknyhawqhrqwviqefklwdnelqyvdqllkedvrnn
svwnqryfvisnttgyndravlerevqytlemiklvphnesawnylkgilqdrglskypn
llnqlldlqpshsspyliaflvdiyedmlenqcdnkedilnkalelceilakekdtirke
ywryigrslqskhst

SCOP Domain Coordinates for d1sa4a_:

Click to download the PDB-style file with coordinates for d1sa4a_.
(The format of our PDB-style files is described here.)

Timeline for d1sa4a_: