SCOP 1.69: Domain d1s9xa2: 1s9x A:1-181

Lineage for d1s9xa2 (1s9x A:1-181)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species)

7. Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (36 PDB entries)

8. Domain d1s9xa2: 1s9x A:1-181 [105395]
   Other proteins in same PDB: d1s9xa1, d1s9xb_

Details for d1s9xa2

PDB Entry: 1s9x, 2.5 Å

PDB Description: crystal structure analysis of ny-eso-1 epitope analogue, sllmwitqa, in complex with hla-a2

SCOP Domain Sequences for d1s9xa2:

Sequence; same for both SEQRES and ATOM records:

>d1s9xa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

Timeline for d1s9xa2:

• d1s9xa2 is new in SCOP 1.69
  
• d1s9xa2 appears in SCOP 1.71
  
• d1s9xa2 appears in the current release, SCOPe 2.08