Lineage for d1s9ua_ (1s9u A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.184: TorD-like [89154] (1 superfamily)
multihelical; bundleSuperfamily a.184.1: TorD-like [89155] (1 family) 
Family a.184.1.1: TorD-like [89156] (5 proteins)
Pfam PF06192
Protein Putative component of anaerobic dehydrogenases YnfI [110025] (1 species) Species Salmonella typhimurium [TaxId:90371] [110026] (1 PDB entry)
Uniprot Q8ZPK0
Domain d1s9ua_: 1s9u A: [105390]
Structural genomics target
complexed with peg, so4
Details for d1s9ua_
PDB Entry: 1s9u (more details), 1.38 Å
PDB Description: Atomic structure of a putative anaerobic dehydrogenase component
PDB Compounds: (A:) putative component of anaerobic dehydrogenasesSCOPe Domain Sequences for d1s9ua_:
Sequence, based on SEQRES records: (download)
>d1s9ua_ a.184.1.1 (A:) Putative component of anaerobic dehydrogenases YnfI {Salmonella typhimurium [TaxId: 90371]}
sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva
amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqf
emqqnepedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqa
lgqlarltlaqwqaqliipvavkplfr
Sequence, based on observed residues (ATOM records): (download)
>d1s9ua_ a.184.1.1 (A:) Putative component of anaerobic dehydrogenases YnfI {Salmonella typhimurium [TaxId: 90371]}
sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva
amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqe
pedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqalgqlar
ltlaqwqaqliipvavkplfr
SCOPe Domain Coordinates for d1s9ua_:
Click to download the PDB-style file with coordinates for d1s9ua_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1s9ua_:
- d1s9ua_ first appeared in SCOP 1.69
- d1s9ua_ appears in SCOPe 2.04
- d1s9ua_ is called d1s9ua1 in SCOPe 2.06
- d1s9ua_ appears in the current release, SCOPe 2.08, called d1s9ua1
View in 3D