Lineage for d1s9ua_ (1s9u A:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450310Fold a.184: TorD-like (Pfam 06192) [89154] (1 superfamily)
    multihelical; bundle
  4. 450311Superfamily a.184.1: TorD-like (Pfam 06192) [89155] (1 family) (S)
  5. 450312Family a.184.1.1: TorD-like (Pfam 06192) [89156] (2 proteins)
  6. 450313Protein Putative component of anaerobic dehydrogenases YnfI [110025] (1 species)
  7. 450314Species Salmonella typhimurium [TaxId:90371] [110026] (1 PDB entry)
  8. 450315Domain d1s9ua_: 1s9u A: [105390]
    Structural genomics target

Details for d1s9ua_

PDB Entry: 1s9u (more details), 1.38 Å

PDB Description: Atomic structure of a putative anaerobic dehydrogenase component

SCOP Domain Sequences for d1s9ua_:

Sequence, based on SEQRES records: (download)

>d1s9ua_ a.184.1.1 (A:) Putative component of anaerobic dehydrogenases YnfI {Salmonella typhimurium}
sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva
amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqf
emqqnepedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqa
lgqlarltlaqwqaqliipvavkplfr

Sequence, based on observed residues (ATOM records): (download)

>d1s9ua_ a.184.1.1 (A:) Putative component of anaerobic dehydrogenases YnfI {Salmonella typhimurium}
sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva
amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqe
pedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqalgqlar
ltlaqwqaqliipvavkplfr

SCOP Domain Coordinates for d1s9ua_:

Click to download the PDB-style file with coordinates for d1s9ua_.
(The format of our PDB-style files is described here.)

Timeline for d1s9ua_: