![]() | Class a: All alpha proteins [46456] (218 folds) |
![]() | Fold a.184: TorD-like (Pfam 06192) [89154] (1 superfamily) multihelical; bundle |
![]() | Superfamily a.184.1: TorD-like (Pfam 06192) [89155] (1 family) ![]() |
![]() | Family a.184.1.1: TorD-like (Pfam 06192) [89156] (2 proteins) |
![]() | Protein Putative component of anaerobic dehydrogenases YnfI [110025] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [110026] (1 PDB entry) |
![]() | Domain d1s9ua_: 1s9u A: [105390] Structural genomics target |
PDB Entry: 1s9u (more details), 1.38 Å
SCOP Domain Sequences for d1s9ua_:
Sequence, based on SEQRES records: (download)
>d1s9ua_ a.184.1.1 (A:) Putative component of anaerobic dehydrogenases YnfI {Salmonella typhimurium} sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqf emqqnepedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqa lgqlarltlaqwqaqliipvavkplfr
>d1s9ua_ a.184.1.1 (A:) Putative component of anaerobic dehydrogenases YnfI {Salmonella typhimurium} sdamttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapva amfkthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqe pedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqalgqlar ltlaqwqaqliipvavkplfr
Timeline for d1s9ua_: