Lineage for d1s9ua1 (1s9u A:1-204)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014370Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2014371Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2014372Family a.184.1.1: TorD-like [89156] (5 protein domains)
    Pfam PF06192
  6. 2014378Protein Putative component of anaerobic dehydrogenases YnfI [110025] (1 species)
  7. 2014379Species Salmonella typhimurium [TaxId:90371] [110026] (1 PDB entry)
    Uniprot Q8ZPK0
  8. 2014380Domain d1s9ua1: 1s9u A:1-204 [105390]
    Other proteins in same PDB: d1s9ua2
    Structural genomics target
    complexed with peg, so4

Details for d1s9ua1

PDB Entry: 1s9u (more details), 1.38 Å

PDB Description: Atomic structure of a putative anaerobic dehydrogenase component
PDB Compounds: (A:) putative component of anaerobic dehydrogenases

SCOPe Domain Sequences for d1s9ua1:

Sequence, based on SEQRES records: (download)

>d1s9ua1 a.184.1.1 (A:1-204) Putative component of anaerobic dehydrogenases YnfI {Salmonella typhimurium [TaxId: 90371]}
mttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapvaamf
kthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqfemq
qnepedhfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqalgq
larltlaqwqaqliipvavkplfr

Sequence, based on observed residues (ATOM records): (download)

>d1s9ua1 a.184.1.1 (A:1-204) Putative component of anaerobic dehydrogenases YnfI {Salmonella typhimurium [TaxId: 90371]}
mttflqrdefavtarvlgalfyyspeshetaplvqallnddwqaqwpldaealapvaamf
kthseeslpqawqrlfigpyalpsppwgsvwldresvlfgdstlalrqwmrengiqeped
hfgsllllaawlaendrhheceqllawhlfpwssrfldvfidhaghpfyqalgqlarltl
aqwqaqliipvavkplfr

SCOPe Domain Coordinates for d1s9ua1:

Click to download the PDB-style file with coordinates for d1s9ua1.
(The format of our PDB-style files is described here.)

Timeline for d1s9ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1s9ua2