Lineage for d1s9qa_ (1s9q A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008798Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 2008799Species Human (Homo sapiens) [TaxId:9606] [81917] (14 PDB entries)
    Uniprot O75454 233-458
  8. 2008803Domain d1s9qa_: 1s9q A: [105388]
    complexed with chd, oht

Details for d1s9qa_

PDB Entry: 1s9q (more details), 2.2 Å

PDB Description: crystal structure of the ligand-binding domain of the estrogen-related receptor gamma in complex with 4-hydroxytamoxifen
PDB Compounds: (A:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d1s9qa_:

Sequence, based on SEQRES records: (download)

>d1s9qa_ a.123.1.1 (A:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
kpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfst
lsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailq
lvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedp
rragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemlea

Sequence, based on observed residues (ATOM records): (download)

>d1s9qa_ a.123.1.1 (A:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
kpynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfst
lsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailq
lvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedp
rragkmlmtlpllrqtstkavqhfyniklegvpmhklflemlea

SCOPe Domain Coordinates for d1s9qa_:

Click to download the PDB-style file with coordinates for d1s9qa_.
(The format of our PDB-style files is described here.)

Timeline for d1s9qa_: