Lineage for d1s9pc_ (1s9p C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012275Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 2012276Species Human (Homo sapiens) [TaxId:9606] [81917] (14 PDB entries)
    Uniprot O75454 233-458
  8. 2012290Domain d1s9pc_: 1s9p C: [105386]
    complexed with des

Details for d1s9pc_

PDB Entry: 1s9p (more details), 2.13 Å

PDB Description: crystal structure of the ligand-binding domain of the estrogen-related receptor gamma in complex with diethylstilbestrol
PDB Compounds: (C:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d1s9pc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9pc_ a.123.1.1 (C:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
ynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstls
ladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlv
kkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprr
agkmlmtlpllrqtstkavqhfyniklegkvpmhklfle

SCOPe Domain Coordinates for d1s9pc_:

Click to download the PDB-style file with coordinates for d1s9pc_.
(The format of our PDB-style files is described here.)

Timeline for d1s9pc_: