Lineage for d1s9pb_ (1s9p B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647998Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 647999Species Human (Homo sapiens) [TaxId:9606] [81917] (11 PDB entries)
  8. 648010Domain d1s9pb_: 1s9p B: [105385]

Details for d1s9pb_

PDB Entry: 1s9p (more details), 2.13 Å

PDB Description: crystal structure of the ligand-binding domain of the estrogen-related receptor gamma in complex with diethylstilbestrol
PDB Compounds: (B:) Estrogen-related receptor gamma

SCOP Domain Sequences for d1s9pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9pb_ a.123.1.1 (B:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
ynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstls
ladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlv
kkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprr
agkmlmtlpllrqtstkavqhfyniklegkvpmhklf

SCOP Domain Coordinates for d1s9pb_:

Click to download the PDB-style file with coordinates for d1s9pb_.
(The format of our PDB-style files is described here.)

Timeline for d1s9pb_: