Lineage for d1s9pa_ (1s9p A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 543419Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 543420Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 543421Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 543525Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 543526Species Human (Homo sapiens) [TaxId:9606] [81917] (5 PDB entries)
  8. 543529Domain d1s9pa_: 1s9p A: [105384]

Details for d1s9pa_

PDB Entry: 1s9p (more details), 2.13 Å

PDB Description: crystal structure of the ligand-binding domain of the estrogen-related receptor gamma in complex with diethylstilbestrol

SCOP Domain Sequences for d1s9pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9pa_ a.123.1.1 (A:) Orphan nuclear receptor ERR3 {Human (Homo sapiens)}
pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
ragkmlmtlpllrqtstkavqhfyniklegkvpmh

SCOP Domain Coordinates for d1s9pa_:

Click to download the PDB-style file with coordinates for d1s9pa_.
(The format of our PDB-style files is described here.)

Timeline for d1s9pa_: