Lineage for d1s9hc1 (1s9h C:225-490)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2479032Family c.37.1.20: Extended AAA-ATPase domain [81269] (42 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2479363Protein Rep 40 protein helicase domain [110564] (1 species)
  7. 2479364Species Adeno-associated virus 2, AAV2 [TaxId:10804] [110565] (2 PDB entries)
    Uniprot P03132 225-490
  8. 2479368Domain d1s9hc1: 1s9h C:225-490 [105383]
    Other proteins in same PDB: d1s9ha2, d1s9hb2, d1s9hc2

Details for d1s9hc1

PDB Entry: 1s9h (more details), 2.4 Å

PDB Description: Crystal Structure of Adeno-associated virus Type 2 Rep40
PDB Compounds: (C:) Rep 40 protein

SCOPe Domain Sequences for d1s9hc1:

Sequence, based on SEQRES records: (download)

>d1s9hc1 c.37.1.20 (C:225-490) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}
melvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapdyl
vgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktnia
eaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvdqk
ckssaqidptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvtkq
evkdffrwakdhvvevehefyvkkgg

Sequence, based on observed residues (ATOM records): (download)

>d1s9hc1 c.37.1.20 (C:225-490) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}
melvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapdyl
vgqsnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattniaeaiahtvpfy
gccvdkmviwweaqidptpvivtsntnlqdrmfkfeltrrldhdfgkvtkqevkdffrwa
kdhvvevehefyvkkgg

SCOPe Domain Coordinates for d1s9hc1:

Click to download the PDB-style file with coordinates for d1s9hc1.
(The format of our PDB-style files is described here.)

Timeline for d1s9hc1: