Lineage for d1s9hb_ (1s9h B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 990157Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 990398Protein Rep 40 protein helicase domain [110564] (1 species)
  7. 990399Species Adeno-associated virus 2, AAV2 [TaxId:10804] [110565] (2 PDB entries)
    Uniprot P03132 225-490
  8. 990402Domain d1s9hb_: 1s9h B: [105382]

Details for d1s9hb_

PDB Entry: 1s9h (more details), 2.4 Å

PDB Description: Crystal Structure of Adeno-associated virus Type 2 Rep40
PDB Compounds: (B:) Rep 40 protein

SCOPe Domain Sequences for d1s9hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9hb_ c.37.1.20 (B:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]}
gmelvgwlvdkgitsekqwiqedqasyisfnaasnsrsqikaaldnagkimsltktapdy
lvgqqpvedissnriykilelngydpqyaasvflgwatkkfgkrntiwlfgpattgktni
aeaiahtvpfygcvnwtnenfpfndcvdkmviwweegkmtakvvesakailggskvrvdq
kckssaqidptpvivtsntnmcavidgnsttfehqqplqdrmfkfeltrrldhdfgkvtk
qevkdffrwakdhvvevehefyvkkgg

SCOPe Domain Coordinates for d1s9hb_:

Click to download the PDB-style file with coordinates for d1s9hb_.
(The format of our PDB-style files is described here.)

Timeline for d1s9hb_: