SCOPe 2.08: Domain d1s9ab_: 1s9a B:

Lineage for d1s9ab_ (1s9a B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species)
   similar overall structure to Catechol 1,2-dioxygenase

7. Species Rhodococcus opacus [TaxId:37919] [110097] (5 PDB entries)
   Uniprot O67987

8. Domain d1s9ab_: 1s9a B: [105380]
   complexed with bez, fe, hgp, tam

Details for d1s9ab_

PDB Entry: 1s9a, 2.47 Å

PDB Description: crystal structure of 4-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp

PDB Compounds: (B:) Chlorocatechol 1,2-dioxygenase

SCOPe Domain Sequences for d1s9ab_:

Sequence; same for both SEQRES and ATOM records:

>d1s9ab_ b.3.6.1 (B:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn

Timeline for d1s9ab_:

• d1s9ab_ first appeared in SCOP 1.69
  
• d1s9ab_ appears in SCOPe 2.07