![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species) similar overall structure to Catechol 1,2-dioxygenase |
![]() | Species Rhodococcus opacus [TaxId:37919] [110097] (1 PDB entry) Uniprot O67987 |
![]() | Domain d1s9aa_: 1s9a A: [105379] complexed with bez, fe, hgp, tam |
PDB Entry: 1s9a (more details), 2.47 Å
SCOPe Domain Sequences for d1s9aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus [TaxId: 37919]} antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid getwqlvdfnfilqhn
Timeline for d1s9aa_: