SCOP 1.69: Domain d1s9aa_: 1s9a A:

Lineage for d1s9aa_ (1s9a A:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species)
   similar overall structure to Catechol 1,2-dioxygenase

7. Species Rhodococcus opacus [TaxId:37919] [110097] (1 PDB entry)

8. Domain d1s9aa_: 1s9a A: [105379]

Details for d1s9aa_

PDB Entry: 1s9a, 2.47 Å

PDB Description: crystal structure of 4-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp

SCOP Domain Sequences for d1s9aa_:

Sequence; same for both SEQRES and ATOM records:

>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn

Timeline for d1s9aa_:

• d1s9aa_ is new in SCOP 1.69
  
• d1s9aa_ appears in SCOP 1.71
  
• d1s9aa_ appears in the current release, SCOPe 2.08