Lineage for d1s9aa_ (1s9a A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 457077Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 457416Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 457417Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 457428Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species)
    similar overall structure to Catechol 1,2-dioxygenase
  7. 457429Species Rhodococcus opacus [TaxId:37919] [110097] (1 PDB entry)
  8. 457430Domain d1s9aa_: 1s9a A: [105379]

Details for d1s9aa_

PDB Entry: 1s9a (more details), 2.47 Å

PDB Description: crystal structure of 4-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp

SCOP Domain Sequences for d1s9aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus}
antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds
vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga
vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm
nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid
getwqlvdfnfilqhn

SCOP Domain Coordinates for d1s9aa_:

Click to download the PDB-style file with coordinates for d1s9aa_.
(The format of our PDB-style files is described here.)

Timeline for d1s9aa_: