Class b: All beta proteins [48724] (144 folds) |
Fold b.3: Prealbumin-like [49451] (6 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) |
Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins) sandwich; 9 strands in 2 sheets |
Protein Chlorocatechol 1,2-dioxygenase [110096] (1 species) similar overall structure to Catechol 1,2-dioxygenase |
Species Rhodococcus opacus [TaxId:37919] [110097] (1 PDB entry) |
Domain d1s9aa_: 1s9a A: [105379] |
PDB Entry: 1s9a (more details), 2.47 Å
SCOP Domain Sequences for d1s9aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s9aa_ b.3.6.1 (A:) Chlorocatechol 1,2-dioxygenase {Rhodococcus opacus} antrvielfdeftdlirdfivrheittpeyetimqymisvgeagewplwldaffettvds vsygkgnwtssaiqgpffkegaplltgkpatlpmradepgdrmrftgsvrdtsgtpitga vidvwhstndgnysffspalpdqyllrgrvvpaedgsiefhsirpvpyeipkagptgqlm nsylgrhswrpahihiritadgyrplitqlyfegdpyldsdscsavkselvlpvnkidid getwqlvdfnfilqhn
Timeline for d1s9aa_: