Lineage for d1s98b_ (1s98 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824351Fold b.124: HesB-like domain [89359] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2824352Superfamily b.124.1: HesB-like domain [89360] (2 families) (S)
  5. 2824353Family b.124.1.1: HesB-like domain [89361] (3 proteins)
    Pfam PF01521; Iron-sulfur cluster scaffold domain
  6. 2824354Protein Fe-S scaffold protein IscA (YfhF) [101849] (1 species)
  7. 2824355Species Escherichia coli [TaxId:562] [101850] (3 PDB entries)
    Uniprot P36539
  8. 2824359Domain d1s98b_: 1s98 B: [105378]

Details for d1s98b_

PDB Entry: 1s98 (more details), 2.3 Å

PDB Description: e.coli isca crystal structure to 2.3 a
PDB Compounds: (B:) Protein yfhF

SCOPe Domain Sequences for d1s98b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s98b_ b.124.1.1 (B:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli [TaxId: 562]}
sitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgvk
vvvdgksmqfldgtqldfvkeglnegfkftnpnvkde

SCOPe Domain Coordinates for d1s98b_:

Click to download the PDB-style file with coordinates for d1s98b_.
(The format of our PDB-style files is described here.)

Timeline for d1s98b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s98a_