Lineage for d1s98a_ (1s98 A:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 472949Fold b.124: HesB-like domain [89359] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 472950Superfamily b.124.1: HesB-like domain [89360] (1 family) (S)
  5. 472951Family b.124.1.1: HesB-like domain [89361] (2 proteins)
    Pfam 01521; Iron-sulfur cluster scaffold domain
  6. 472952Protein Fe-S scaffold protein IscA (YfhF) [101849] (1 species)
  7. 472953Species Escherichia coli [TaxId:562] [101850] (3 PDB entries)
  8. 472954Domain d1s98a_: 1s98 A: [105377]

Details for d1s98a_

PDB Entry: 1s98 (more details), 2.3 Å

PDB Description: e.coli isca crystal structure to 2.3 a

SCOP Domain Sequences for d1s98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s98a_ b.124.1.1 (A:) Fe-S scaffold protein IscA (YfhF) {Escherichia coli}
sitlsdsaaarvntflanrgkgfglrlgvrtsgcsgmayvlefvdeptpedivfedkgvk
vvvdgksmqfldgtqldfvkeglnegfkftnpnvkde

SCOP Domain Coordinates for d1s98a_:

Click to download the PDB-style file with coordinates for d1s98a_.
(The format of our PDB-style files is described here.)

Timeline for d1s98a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s98b_