Lineage for d1s95b_ (1s95 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998036Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 2998037Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 2998136Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 2998251Protein Serine/threonine protein phosphatase 5, PP5 [111231] (1 species)
  7. 2998252Species Human (Homo sapiens) [TaxId:9606] [111232] (14 PDB entries)
    Uniprot P53041 176-499
  8. 2998267Domain d1s95b_: 1s95 B: [105376]
    complexed with mn, mpd, po4

Details for d1s95b_

PDB Entry: 1s95 (more details), 1.6 Å

PDB Description: structure of serine/threonine protein phosphatase 5
PDB Compounds: (B:) serine/threonine protein phosphatase 5

SCOPe Domain Sequences for d1s95b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s95b_ d.159.1.3 (B:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]}
eysgpkledgkvtisfmkelmqwykdqkklhrkcayqilvqvkevlsklstlvettlket
ekitvcgdthgqfydllnifelnglpsetnpyifngdfvdrgsfsveviltlfgfkllyp
dhfhllrgnhetdnmnqiygfegevkakytaqmyelfsevfewlplaqcingkvlimhgg
lfsedgvtlddirkiernrqppdsgpmcdllwsdpqpqngrsiskrgvscqfgpdvtkaf
leennldyiirshevkaegyevahggrcvtvfsapnycdqmgnkasyihlqgsdlrpqfh
qftavphpnvkpmayantllqlgmm

SCOPe Domain Coordinates for d1s95b_:

Click to download the PDB-style file with coordinates for d1s95b_.
(The format of our PDB-style files is described here.)

Timeline for d1s95b_: