SCOP 1.71: Domain d1s8eb_: 1s8e B:

Lineage for d1s8eb_ (1s8e B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (9 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam 00149

5. Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein)
   contains C-terminal alpha/beta subdomain

6. Protein Mre11 [64428] (1 species)

7. Species Archaeon Pyrococcus furiosus [TaxId:2261] [64429] (2 PDB entries)

8. Domain d1s8eb_: 1s8e B: [105369]
   complexed with mn; mutant

Details for d1s8eb_

PDB Entry: 1s8e, 2.3 Å

PDB Description: crystal structure of mre11-3

SCOP Domain Sequences for d1s8eb_:

Sequence; same for both SEQRES and ATOM records:

>d1s8eb_ d.159.1.4 (B:) Mre11 {Archaeon Pyrococcus furiosus}
mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
lkkaiallqipkehsipvfaiegnlvrtqrgpsvlnlledfglvyvigmrkekveneylt
serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
yvrlnigwrkpfdlteikellnveylkidtwri

Timeline for d1s8eb_:

• d1s8eb_ first appeared in SCOP 1.69
  
• d1s8eb_ appears in SCOP 1.73
  
• d1s8eb_ appears in the current release, SCOPe 2.08