Lineage for d1s8eb_ (1s8e B:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513455Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 513456Superfamily d.159.1: Metallo-dependent phosphatases [56300] (7 families) (S)
  5. 513525Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein)
    contains C-terminal alpha/beta subdomain
  6. 513526Protein Mre11 [64428] (1 species)
  7. 513527Species Archaeon Pyrococcus furiosus [TaxId:2261] [64429] (2 PDB entries)
  8. 513531Domain d1s8eb_: 1s8e B: [105369]

Details for d1s8eb_

PDB Entry: 1s8e (more details), 2.3 Å

PDB Description: crystal structure of mre11-3

SCOP Domain Sequences for d1s8eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8eb_ d.159.1.4 (B:) Mre11 {Archaeon Pyrococcus furiosus}
mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
lkkaiallqipkehsipvfaiegnlvrtqrgpsvlnlledfglvyvigmrkekveneylt
serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
yvrlnigwrkpfdlteikellnveylkidtwri

SCOP Domain Coordinates for d1s8eb_:

Click to download the PDB-style file with coordinates for d1s8eb_.
(The format of our PDB-style files is described here.)

Timeline for d1s8eb_: