Lineage for d1s8ea_ (1s8e A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1680059Family d.159.1.4: DNA double-strand break repair nuclease [64427] (1 protein)
    contains C-terminal alpha/beta subdomain
  6. 1680060Protein Mre11 [64428] (1 species)
  7. 1680061Species Pyrococcus furiosus [TaxId:2261] [64429] (5 PDB entries)
    Uniprot Q8U1N9
  8. 1680066Domain d1s8ea_: 1s8e A: [105368]
    complexed with mn

Details for d1s8ea_

PDB Entry: 1s8e (more details), 2.3 Å

PDB Description: crystal structure of mre11-3
PDB Compounds: (A:) exonuclease putative

SCOPe Domain Sequences for d1s8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s8ea_ d.159.1.4 (A:) Mre11 {Pyrococcus furiosus [TaxId: 2261]}
mkfahladihlgyeqfhkpqreeefaeafknaleiavqenvdfiliagdlfhssrpspgt
lkkaiallqipkehsipvfaiegnlvrtqrgpsvlnlledfglvyvigmrkekveneylt
serlgngeylvkgvykdleihgmkymssawfeankeilkrlfrptdnailmlhqgvrevs
eargedyfeiglgdlpegylyyalghihkryetsysgspvvypgslerwdfgdyevryew
dgikfkerygvnkgfyivedfkprfveikvrpfidvkikgseeeirkaikrliplipkna
yvrlnigwrkpfdlteikellnveylkidtwri

SCOPe Domain Coordinates for d1s8ea_:

Click to download the PDB-style file with coordinates for d1s8ea_.
(The format of our PDB-style files is described here.)

Timeline for d1s8ea_: